General Information

  • ID:  hor000995
  • Uniprot ID:  P06307(21-115)
  • Protein name:  Cholecystokinin
  • Gene name:  CCK
  • Organism:  Homo sapiens (Human)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with CCK include Cholecystitis and Biliary Dyskinesia.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  QPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  • Length:  95(21-115)
  • Propeptide:  MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  • Signal peptide:  MNSGVCLCVLMAVLAAGALT
  • Modification:  T77 Sulfotyrosine;T83 Phenylalanine amide;T91 Sulfotyrosine;T93 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  77-77Y->F: Reduces the quantity of secreted CCK8 by 50%.

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKAR
  • Target Unid:  P32238
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06307-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000995_AF2.pdbhor000995_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1242681 Formula: C460H734N150O143S3
Absent amino acids: C Common amino acids: R
pI: 9.98 Basic residues: 17
Polar residues: 23 Hydrophobic residues: 25
Hydrophobicity: -101.68 Boman Index: -29499
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 60.74
Instability Index: 8047.16 Extinction Coefficient cystines: 11460
Absorbance 280nm: 121.91

Literature

  • PubMed ID:  NA
  • Title:  NA